Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins) automatically mapped to Pfam PF00574 |
Protein automated matches [190149] (14 species) not a true protein |
Species Francisella tularensis [TaxId:263] [324166] (3 PDB entries) |
Domain d5g1qc_: 5g1q C: [324345] automated match to d3p2la_ |
PDB Entry: 5g1q (more details), 2.84 Å
SCOPe Domain Sequences for d5g1qc_:
Sequence, based on SEQRES records: (download)
>d5g1qc_ c.14.1.1 (C:) automated matches {Francisella tularensis [TaxId: 263]} lvptviektaggerafdiysrllkerivflngevndhsanlviaqllflesedpdkdiyf yinspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslpssqimi hqplggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmmadeaka yglidhvies
>d5g1qc_ c.14.1.1 (C:) automated matches {Francisella tularensis [TaxId: 263]} lvptviggerafdiysrllkerivflngevndhsanlviaqllflesedpdkdiyfyins pggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslpssqimihqpl ghaknilrikdrlnkvlahhtgqdletivkdtdrdnfmmadeakayglidhvies
Timeline for d5g1qc_: