Lineage for d5g1qg_ (5g1q G:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2435650Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2435651Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2435652Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
    automatically mapped to Pfam PF00574
  6. 2435832Protein automated matches [190149] (11 species)
    not a true protein
  7. 2435981Species Francisella tularensis [TaxId:263] [324166] (3 PDB entries)
  8. 2436016Domain d5g1qg_: 5g1q G: [324297]
    automated match to d3p2la_

Details for d5g1qg_

PDB Entry: 5g1q (more details), 2.84 Å

PDB Description: compressed conformation of francisella tularensis clpp at 2.84 a
PDB Compounds: (G:) clp protease proteolytic subunit p

SCOPe Domain Sequences for d5g1qg_:

Sequence, based on SEQRES records: (download)

>d5g1qg_ c.14.1.1 (G:) automated matches {Francisella tularensis [TaxId: 263]}
nlvptviektaggerafdiysrllkerivflngevndhsanlviaqllflesedpdkdiy
fyinspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslpssqim
ihqplggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmmadeak
ayglidhviesr

Sequence, based on observed residues (ATOM records): (download)

>d5g1qg_ c.14.1.1 (G:) automated matches {Francisella tularensis [TaxId: 263]}
nlvptvierafdiysrllkerivflngevndhsanlviaqllflesedpdkdiyfyinsp
ggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslpssqimihqplg
gfhaknilrikdrlnkvlahhtgqdletivkdtdrdnfmmadeakayglidhviesr

SCOPe Domain Coordinates for d5g1qg_:

Click to download the PDB-style file with coordinates for d5g1qg_.
(The format of our PDB-style files is described here.)

Timeline for d5g1qg_: