PDB entry 5g1q

View 5g1q on RCSB PDB site
Description: Compressed conformation of Francisella tularensis ClpP at 2.84 A
Class: hydrolase
Keywords: hydrolase
Deposited on 2016-03-29, released 2016-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 2.84 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: clp protease proteolytic subunit p
    Species: FRANCISELLA TULARENSIS [TaxId:263]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5g1qa_
  • Chain 'B':
    Compound: clp protease proteolytic subunit p
    Species: FRANCISELLA TULARENSIS [TaxId:263]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5g1qb_
  • Chain 'C':
    Compound: clp protease proteolytic subunit p
    Species: FRANCISELLA TULARENSIS [TaxId:263]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5g1qc_
  • Chain 'D':
    Compound: clp protease proteolytic subunit p
    Species: FRANCISELLA TULARENSIS [TaxId:263]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5g1qd_
  • Chain 'E':
    Compound: clp protease proteolytic subunit p
    Species: FRANCISELLA TULARENSIS [TaxId:263]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5g1qe_
  • Chain 'F':
    Compound: clp protease proteolytic subunit p
    Species: FRANCISELLA TULARENSIS [TaxId:263]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5g1qf_
  • Chain 'G':
    Compound: clp protease proteolytic subunit p
    Species: FRANCISELLA TULARENSIS [TaxId:263]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5g1qg_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5g1qA (A:)
    mitnnlvptviektaggerafdiysrllkerivflngevndhsanlviaqllflesedpd
    kdiyfyinspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslps
    sqimihqplggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmma
    deakayglidhviesreaiik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g1qA (A:)
    lvptviektaggerafdiysrllkerivflngevndhsanlviaqllflesedpdkdiyf
    yinspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslpssqimi
    hqplgeihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmmadeakayglidhvie
    s
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5g1qB (B:)
    mitnnlvptviektaggerafdiysrllkerivflngevndhsanlviaqllflesedpd
    kdiyfyinspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslps
    sqimihqplggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmma
    deakayglidhviesreaiik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g1qB (B:)
    lvptvierafdiysrllkerivflngevndhsanlviaqllflesedpdkdiyfyinspg
    gmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslpssqimihqplga
    knilrikdrlnkvlahhtgqdletivkdtdrdnfmmadeakayglidhvies
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5g1qC (C:)
    mitnnlvptviektaggerafdiysrllkerivflngevndhsanlviaqllflesedpd
    kdiyfyinspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslps
    sqimihqplggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmma
    deakayglidhviesreaiik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g1qC (C:)
    lvptviggerafdiysrllkerivflngevndhsanlviaqllflesedpdkdiyfyins
    pggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslpssqimihqpl
    ghaknilrikdrlnkvlahhtgqdletivkdtdrdnfmmadeakayglidhvies
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5g1qD (D:)
    mitnnlvptviektaggerafdiysrllkerivflngevndhsanlviaqllflesedpd
    kdiyfyinspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslps
    sqimihqplggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmma
    deakayglidhviesreaiik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g1qD (D:)
    lvptvifdiysrllkerivflngevndhsanlviaqllflesedpdkdiyfyinspggmv
    tagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslpssqimihqplggakn
    ilrikdrlnkvlahhtgqdletivkdtdrdnfmmadeakayglidhvies
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5g1qE (E:)
    mitnnlvptviektaggerafdiysrllkerivflngevndhsanlviaqllflesedpd
    kdiyfyinspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslps
    sqimihqplggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmma
    deakayglidhviesreaiik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g1qE (E:)
    vptviefdiysrllkerivflngevndhsanlviaqllflesedpdkdiyfyinspggmv
    tagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslpssqimihqplggakn
    ilrikdrlnkvlahhtgqdletivkdtdrdnfmmadeakayglidhviesr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5g1qF (F:)
    mitnnlvptviektaggerafdiysrllkerivflngevndhsanlviaqllflesedpd
    kdiyfyinspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslps
    sqimihqplggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmma
    deakayglidhviesreaiik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g1qF (F:)
    lvptvieafdiysrllkerivflngevndhsanlviaqllflesedpdkdiyfyinspgg
    mvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslpssqimihqplgha
    knilrikdrlnkvlahhtgqdletivkdtdrdnfmmadeakayglidhvie
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5g1qG (G:)
    mitnnlvptviektaggerafdiysrllkerivflngevndhsanlviaqllflesedpd
    kdiyfyinspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslps
    sqimihqplggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmma
    deakayglidhviesreaiik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g1qG (G:)
    nlvptvierafdiysrllkerivflngevndhsanlviaqllflesedpdkdiyfyinsp
    ggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslpssqimihqplg
    gfhaknilrikdrlnkvlahhtgqdletivkdtdrdnfmmadeakayglidhviesr