Lineage for d5g1qc_ (5g1q C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2112071Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2112072Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2112073Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
    automatically mapped to Pfam PF00574
  6. 2112253Protein automated matches [190149] (9 species)
    not a true protein
  7. 2112402Species Francisella tularensis [TaxId:263] [324166] (3 PDB entries)
  8. 2112433Domain d5g1qc_: 5g1q C: [324345]
    automated match to d3p2la_

Details for d5g1qc_

PDB Entry: 5g1q (more details), 2.84 Å

PDB Description: compressed conformation of francisella tularensis clpp at 2.84 a
PDB Compounds: (C:) clp protease proteolytic subunit p

SCOPe Domain Sequences for d5g1qc_:

Sequence, based on SEQRES records: (download)

>d5g1qc_ c.14.1.1 (C:) automated matches {Francisella tularensis [TaxId: 263]}
lvptviektaggerafdiysrllkerivflngevndhsanlviaqllflesedpdkdiyf
yinspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslpssqimi
hqplggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmmadeaka
yglidhvies

Sequence, based on observed residues (ATOM records): (download)

>d5g1qc_ c.14.1.1 (C:) automated matches {Francisella tularensis [TaxId: 263]}
lvptviggerafdiysrllkerivflngevndhsanlviaqllflesedpdkdiyfyins
pggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslpssqimihqpl
ghaknilrikdrlnkvlahhtgqdletivkdtdrdnfmmadeakayglidhvies

SCOPe Domain Coordinates for d5g1qc_:

Click to download the PDB-style file with coordinates for d5g1qc_.
(The format of our PDB-style files is described here.)

Timeline for d5g1qc_: