![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
![]() | Protein automated matches [190069] (239 species) not a true protein |
![]() | Species Burkholderia cenocepacia [TaxId:216591] [193149] (10 PDB entries) |
![]() | Domain d5thkb1: 5thk B:2-257 [324113] Other proteins in same PDB: d5thkb2, d5thkg2 automated match to d4rf5a_ complexed with 1pe, mg, nap |
PDB Entry: 5thk (more details), 1.4 Å
SCOPe Domain Sequences for d5thkb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5thkb1 c.2.1.0 (B:2-257) automated matches {Burkholderia cenocepacia [TaxId: 216591]} athtladkvvliaggaknlggliardlaghgakavaihynsaasqaqaeetaaavraaga eaatfqadlttaaaveklfddakqrfgkidiaintvgkvlkkpfteiseaeydemfavns ksafffikeagrhledhgklvtlvtsllgaftpfyaayegskapvehftraaskeygarg isvtavgpgpmdtpffypaegadavayhktaaalspfsktgltdiedvvpfirhlvtdgw witgqtilinggyttk
Timeline for d5thkb1: