Lineage for d4rf5a_ (4rf5 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106799Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2106800Protein automated matches [190069] (239 species)
    not a true protein
  7. 2108002Species Lactobacillus kefiri [TaxId:33962] [277547] (4 PDB entries)
  8. 2108003Domain d4rf5a_: 4rf5 A: [277548]
    automated match to d2rhcb_
    complexed with gol, mg; mutant

Details for d4rf5a_

PDB Entry: 4rf5 (more details), 1.6 Å

PDB Description: crystal structure of ketoreductase from lactobacillus kefir, e145s mutant
PDB Compounds: (A:) NADPH dependent R-specific alcohol dehydrogenase

SCOPe Domain Sequences for d4rf5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rf5a_ c.2.1.0 (A:) automated matches {Lactobacillus kefiri [TaxId: 33962]}
tdrlkgkvaivtggtlgiglaiadkfveegakvvitgrhadvgekaaksiggtdvirfvq
hdasdeagwtklfdtteeafgpvttvvnnagiavsksvedttteewrkllsvnldgvffg
trlgiqrmknkglgasiinmssisgfvgdptlgaynaskgavrimsksaaldcalkdydv
rvntvhpgyiktplvddlegaeemmsqrtktpmghigepndiawicvylasdeskfatga
efvvdggytaq

SCOPe Domain Coordinates for d4rf5a_:

Click to download the PDB-style file with coordinates for d4rf5a_.
(The format of our PDB-style files is described here.)

Timeline for d4rf5a_: