Lineage for d4rf5a_ (4rf5 A:)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similarSuperfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) 
Family c.2.1.0: automated matches [191313] (1 protein)
not a true familyProtein automated matches [190069] (239 species)
not a true protein
Species Lactobacillus kefiri [TaxId:33962] [277547] (4 PDB entries) 
Domain d4rf5a_: 4rf5 A: [277548]
automated match to d2rhcb_
complexed with gol, mg; mutant
Details for d4rf5a_
PDB Entry: 4rf5 (more details), 1.6 Å
PDB Description: crystal structure of ketoreductase from lactobacillus kefir, e145s mutant
PDB Compounds: (A:) NADPH dependent R-specific alcohol dehydrogenaseSCOPe Domain Sequences for d4rf5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rf5a_ c.2.1.0 (A:) automated matches {Lactobacillus kefiri [TaxId: 33962]}
tdrlkgkvaivtggtlgiglaiadkfveegakvvitgrhadvgekaaksiggtdvirfvq
hdasdeagwtklfdtteeafgpvttvvnnagiavsksvedttteewrkllsvnldgvffg
trlgiqrmknkglgasiinmssisgfvgdptlgaynaskgavrimsksaaldcalkdydv
rvntvhpgyiktplvddlegaeemmsqrtktpmghigepndiawicvylasdeskfatga
efvvdggytaq
SCOPe Domain Coordinates for d4rf5a_:
Click to download the PDB-style file with coordinates for d4rf5a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4rf5a_:
- d4rf5a_ first appeared in SCOPe 2.05
- d4rf5a_ appears in SCOPe 2.07
- d4rf5a_ appears in the current release, SCOPe 2.08
View in 3D
