Lineage for d5jcwa2 (5jcw A:77-209)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. Protein Class pi GST [81347] (4 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [47619] (66 PDB entries)
  8. Domain d5jcwa2: 5jcw A:77-209 [323969]
    Other proteins in same PDB: d5jcwa1, d5jcwb1
    automated match to d13gsa1
    complexed with act, ca, gsh, gvx, mpd

Details for d5jcwa2

PDB Entry: 5jcw (more details), 1.95 Å

PDB Description: crystal structure of hgstp1-1 with glutathione adduct of phenethyl isothiocyanate
PDB Compounds: (A:) Glutathione S-transferase P

SCOPe Domain Sequences for d5jcwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jcwa2 a.45.1.1 (A:77-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

SCOPe Domain Coordinates for d5jcwa2 are not available.

Timeline for d5jcwa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5jcwa1
View in 3D
Domains from other chains:
(mouse over for more information)
d5jcwb1, d5jcwb2