PDB entry 5jcw

View 5jcw on RCSB PDB site
Description: Crystal Structure of hGSTP1-1 with Glutathione Adduct of Phenethyl Isothiocyanate
Class: transferase
Keywords: GST, PEITC, Glutathione adduct, TRANSFERASE
Deposited on 2016-04-15, released 2016-10-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-10-12, with a file datestamp of 2016-10-07.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutathione S-transferase P
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTP1, FAEES3, GST3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5jcwa1, d5jcwa2
  • Chain 'B':
    Compound: Glutathione S-transferase P
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTP1, FAEES3, GST3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5jcwb1, d5jcwb2
  • Heterogens: GVX, MPD, ACT, CA, GSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jcwA (A:)
    mppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgd
    ltlyqsntilrhlgrtlglygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyv
    kalpgqlkpfetllsqnqggktfivgdqisfadynlldlllihevlapgcldafpllsay
    vgrlsarpklkaflaspeyvnlpingngkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jcwA (A:)
    ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
    tlyqsntilrhlgrtlglygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvk
    alpgqlkpfetllsqnqggktfivgdqisfadynlldlllihevlapgcldafpllsayv
    grlsarpklkaflaspeyvnlpingngkq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5jcwB (B:)
    mppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgd
    ltlyqsntilrhlgrtlglygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyv
    kalpgqlkpfetllsqnqggktfivgdqisfadynlldlllihevlapgcldafpllsay
    vgrlsarpklkaflaspeyvnlpingngkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jcwB (B:)
    ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
    tlyqsntilrhlgrtlglygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvk
    alpgqlkpfetllsqnqggktfivgdqisfadynlldlllihevlapgcldafpllsayv
    grlsarpklkaflaspeyvnlpingngkq