Lineage for d5jczb_ (5jcz B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2334581Superfamily a.118.27: DIL domain-like [310601] (1 family) (S)
    Pfam PF01843
  5. 2334582Family a.118.27.1: DIL domains from class V myosins [310651] (6 protein domains)
  6. 2334613Protein automated matches [310888] (2 species)
    not a true protein
  7. 2334616Species Human (Homo sapiens) [TaxId:9606] [311399] (4 PDB entries)
  8. 2334619Domain d5jczb_: 5jcz B: [323364]
    Other proteins in same PDB: d5jcza_, d5jczd_, d5jczi_
    automated match to d4lwzb_
    complexed with act, bef, edo, gdp, gol, mg

Details for d5jczb_

PDB Entry: 5jcz (more details), 2.06 Å

PDB Description: rab11 bound to myova-gtd
PDB Compounds: (B:) Unconventional myosin-Va

SCOPe Domain Sequences for d5jczb_:

Sequence, based on SEQRES records: (download)

>d5jczb_ a.118.27.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fqgmleykkedeqklvknlilelkprgvavnlipglpayilfmcvrhadylnddqkvrsl
ltstinsikkvlkkrgddfetvsfwlsntcrflhclkqysgeegfmkhntsrqnehcltn
fdlaeyrqvlsdlaiqiyqqlvrvlenilqpmivsgmlehetiqgvsgvkptglrkrtss
iadegtytldsilrqlnsfhsvmcqhgmdpelikqvvkqmfyiigaitlnnlllrkdmcs
wskgmqirynvsqleewlrdknlmnsgaketlepliqaaqllqvkkktdddaeaicsmcn
alttaqivkvlnlytpvnefeervsvsfirtiqmrlrdrkdspqllmdakhifpvtfpfn
psslaletiqipaslglgfisrv

Sequence, based on observed residues (ATOM records): (download)

>d5jczb_ a.118.27.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fqgmleykkedeqklvknlilelkprgvavnlipglpayilfmcvrhadylnddqkvrsl
ltstinsikkvlkkrgddfetvsfwlsntcrflhclkqysgeegfmkhntsrqnehcltn
fdlaeyrqvlsdlaiqiyqqlvrvlenilqpmivsgmlehetiqggtytldsilrqlnsf
hsvmcqhgmdpelikqvvkqmfyiigaitlnnlllrkdmcswskgmqirynvsqleewlr
dknlmnsgaketlepliqaaqllqvkkktdddaeaicsmcnalttaqivkvlnlytpvne
feervsvsfirtiqmrlrdrkdspqllmdakhifpvtfpfnpsslaletiqipaslglgf
isrv

SCOPe Domain Coordinates for d5jczb_:

Click to download the PDB-style file with coordinates for d5jczb_.
(The format of our PDB-style files is described here.)

Timeline for d5jczb_: