Lineage for d5jczi_ (5jcz I:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2872051Species Human (Homo sapiens) [TaxId:9606] [186862] (207 PDB entries)
  8. 2872204Domain d5jczi_: 5jcz I: [323354]
    Other proteins in same PDB: d5jczb_, d5jczc_, d5jcze_
    automated match to d4uj3d_
    complexed with act, bef, edo, gdp, gol, mg

Details for d5jczi_

PDB Entry: 5jcz (more details), 2.06 Å

PDB Description: rab11 bound to myova-gtd
PDB Compounds: (I:) Ras-related protein Rab-11A

SCOPe Domain Sequences for d5jczi_:

Sequence, based on SEQRES records: (download)

>d5jczi_ c.37.1.0 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiwdtagq
eryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnksdlrh
lravptdearafaeknglsfietsaldstnveaafqtilteiyr

Sequence, based on observed residues (ATOM records): (download)

>d5jczi_ c.37.1.0 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lfkvvligdsgvgksnllsrftrnefnleskstigvefatkaqiwdtagqeraitsayyr
gagallvydiakhltyenverwlkelrdhadsvimlvgnksdrhlravptearafaekng
lsfietsaldstnveaafqtilteiyr

SCOPe Domain Coordinates for d5jczi_:

Click to download the PDB-style file with coordinates for d5jczi_.
(The format of our PDB-style files is described here.)

Timeline for d5jczi_: