Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest |
Superfamily c.49.2: ATP synthase (F1-ATPase), gamma subunit [52943] (2 families) contains an antiparallel coiled coil formed by N- and C-terminal extensions to the common fold |
Family c.49.2.0: automated matches [191450] (1 protein) not a true family |
Protein automated matches [190687] (6 species) not a true protein |
Species Caldalkalibacillus thermarum [TaxId:986075] [322942] (2 PDB entries) |
Domain d5ik2g_: 5ik2 G: [323178] Other proteins in same PDB: d5ik2a1, d5ik2a2, d5ik2a3, d5ik2b1, d5ik2b2, d5ik2b3, d5ik2c1, d5ik2c2, d5ik2c3, d5ik2d1, d5ik2d2, d5ik2d3, d5ik2e1, d5ik2e2, d5ik2e3, d5ik2f1, d5ik2f2, d5ik2f3, d5ik2i1, d5ik2i2, d5ik2i3, d5ik2j1, d5ik2j2, d5ik2j3, d5ik2k1, d5ik2k2, d5ik2k3, d5ik2l1, d5ik2l2, d5ik2l3, d5ik2m1, d5ik2m2, d5ik2m3, d5ik2n1, d5ik2n2, d5ik2n3 automated match to d2v7qg_ complexed with adp, gol, mg, po4; mutant |
PDB Entry: 5ik2 (more details), 2.6 Å
SCOPe Domain Sequences for d5ik2g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ik2g_ c.49.2.0 (G:) automated matches {Caldalkalibacillus thermarum [TaxId: 986075]} qgmreikrrirsvkntrqitkamkmvaaaklrraqetaenarpyadkikevissiaagtk dfshpmlearpvkktgymvitsdrglagpynanilrlvsktieerhqskdeyvifavgrk grdffkkrgypvveevtgisdtpslteiqdiaqsaigmfadetfdkltifynefvspivq rpvekqllpltseevldgpvsayeyepdsesvlevllpkyaetliysalldakasefgar mtamgnatdnatemletltlqfnrarqaaitqeiaeivaganalr
Timeline for d5ik2g_:
View in 3D Domains from other chains: (mouse over for more information) d5ik2a1, d5ik2a2, d5ik2a3, d5ik2b1, d5ik2b2, d5ik2b3, d5ik2c1, d5ik2c2, d5ik2c3, d5ik2d1, d5ik2d2, d5ik2d3, d5ik2e1, d5ik2e2, d5ik2e3, d5ik2f1, d5ik2f2, d5ik2f3, d5ik2i1, d5ik2i2, d5ik2i3, d5ik2j1, d5ik2j2, d5ik2j3, d5ik2k1, d5ik2k2, d5ik2k3, d5ik2l1, d5ik2l2, d5ik2l3, d5ik2m1, d5ik2m2, d5ik2m3, d5ik2n1, d5ik2n2, d5ik2n3, d5ik2o_ |