Lineage for d5ik2g_ (5ik2 G:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2488765Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 2488928Superfamily c.49.2: ATP synthase (F1-ATPase), gamma subunit [52943] (2 families) (S)
    contains an antiparallel coiled coil formed by N- and C-terminal extensions to the common fold
  5. 2488973Family c.49.2.0: automated matches [191450] (1 protein)
    not a true family
  6. 2488974Protein automated matches [190687] (6 species)
    not a true protein
  7. 2488977Species Caldalkalibacillus thermarum [TaxId:986075] [322942] (2 PDB entries)
  8. 2488978Domain d5ik2g_: 5ik2 G: [323178]
    Other proteins in same PDB: d5ik2a1, d5ik2a2, d5ik2a3, d5ik2b1, d5ik2b2, d5ik2b3, d5ik2c1, d5ik2c2, d5ik2c3, d5ik2d1, d5ik2d2, d5ik2d3, d5ik2e1, d5ik2e2, d5ik2e3, d5ik2f1, d5ik2f2, d5ik2f3, d5ik2i1, d5ik2i2, d5ik2i3, d5ik2j1, d5ik2j2, d5ik2j3, d5ik2k1, d5ik2k2, d5ik2k3, d5ik2l1, d5ik2l2, d5ik2l3, d5ik2m1, d5ik2m2, d5ik2m3, d5ik2n1, d5ik2n2, d5ik2n3
    automated match to d2v7qg_
    complexed with adp, gol, mg, po4; mutant

Details for d5ik2g_

PDB Entry: 5ik2 (more details), 2.6 Å

PDB Description: caldalaklibacillus thermarum f1-atpase (epsilon mutant)
PDB Compounds: (G:) ATP synthase gamma chain

SCOPe Domain Sequences for d5ik2g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ik2g_ c.49.2.0 (G:) automated matches {Caldalkalibacillus thermarum [TaxId: 986075]}
qgmreikrrirsvkntrqitkamkmvaaaklrraqetaenarpyadkikevissiaagtk
dfshpmlearpvkktgymvitsdrglagpynanilrlvsktieerhqskdeyvifavgrk
grdffkkrgypvveevtgisdtpslteiqdiaqsaigmfadetfdkltifynefvspivq
rpvekqllpltseevldgpvsayeyepdsesvlevllpkyaetliysalldakasefgar
mtamgnatdnatemletltlqfnrarqaaitqeiaeivaganalr

SCOPe Domain Coordinates for d5ik2g_:

Click to download the PDB-style file with coordinates for d5ik2g_.
(The format of our PDB-style files is described here.)

Timeline for d5ik2g_: