Class b: All beta proteins [48724] (178 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies) barrel, closed; n=6, S=8; greek-key Many cradle-loop superfamilies may be homologous, according to PubMed 18457946 |
Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) automatically mapped to Pfam PF02874 |
Family b.49.1.0: automated matches [254232] (1 protein) not a true family |
Protein automated matches [254527] (17 species) not a true protein |
Species Caldalkalibacillus thermarum [TaxId:986075] [322893] (2 PDB entries) |
Domain d5ik2e1: 5ik2 E:1-76 [322961] Other proteins in same PDB: d5ik2a2, d5ik2a3, d5ik2b2, d5ik2b3, d5ik2c2, d5ik2c3, d5ik2d2, d5ik2d3, d5ik2e2, d5ik2e3, d5ik2f2, d5ik2f3, d5ik2g_, d5ik2i2, d5ik2i3, d5ik2j2, d5ik2j3, d5ik2k2, d5ik2k3, d5ik2l2, d5ik2l3, d5ik2m2, d5ik2m3, d5ik2n2, d5ik2n3, d5ik2o_ automated match to d2qe7d1 complexed with adp, gol, mg, po4; mutant |
PDB Entry: 5ik2 (more details), 2.6 Å
SCOPe Domain Sequences for d5ik2e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ik2e1 b.49.1.0 (E:1-76) automated matches {Caldalkalibacillus thermarum [TaxId: 986075]} mnkgriiqvmgpvvdiqfesgqlpdiynaitierpqggtltveaavhlgdnvvrcvamas tdglvrgleavdtgap
Timeline for d5ik2e1:
View in 3D Domains from other chains: (mouse over for more information) d5ik2a1, d5ik2a2, d5ik2a3, d5ik2b1, d5ik2b2, d5ik2b3, d5ik2c1, d5ik2c2, d5ik2c3, d5ik2d1, d5ik2d2, d5ik2d3, d5ik2f1, d5ik2f2, d5ik2f3, d5ik2g_, d5ik2i1, d5ik2i2, d5ik2i3, d5ik2j1, d5ik2j2, d5ik2j3, d5ik2k1, d5ik2k2, d5ik2k3, d5ik2l1, d5ik2l2, d5ik2l3, d5ik2m1, d5ik2m2, d5ik2m3, d5ik2n1, d5ik2n2, d5ik2n3, d5ik2o_ |