Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (22 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
Protein Hexameric replicative helicase repA [52676] (1 species) |
Species Escherichia coli [TaxId:562] [52677] (3 PDB entries) |
Domain d1g8yg_: 1g8y G: [32308] |
PDB Entry: 1g8y (more details), 2.4 Å
SCOPe Domain Sequences for d1g8yg_:
Sequence, based on SEQRES records: (download)
>d1g8yg_ c.37.1.11 (G:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} athkpinileafaaapppldyvlpnmvagtvgalvspggagksmlalqlaaqiaggpdll evgelptgpviylpaedpptaihhrlhalgahlsaeerqavadglliqpligslpnimap ewfdglkraaegrrlmvldtlrrfhieeenasgpmaqvigrmeaiaadtgcsivflhhas kgaammgagdqqqasrgssvlvdnirwqsylssmtsaeaeewgvdddqrrffvrfgvska nygapfadrwfrrhdggvlkpa
>d1g8yg_ c.37.1.11 (G:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} athkpinileafaaapppldyvlpnmvagtvgalvspggagksmlalqlaaqiaggpdll evgelptgpviylpaedpptaihhrlhalgahlsaeerqavadglliqpligslpnimap ewfdglkraaegrrlmvldtlrrfhieeenasgpmaqvigrmeaiaadtgcsivflhhav lvdnirwqsylssmtsaeaeewgvdddqrrffvrfgvskanygapfadrwfrrhdggvlk pa
Timeline for d1g8yg_: