Lineage for d1g8yf_ (1g8y F:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2112131Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 protein domains)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2112502Protein Hexameric replicative helicase repA [52676] (1 species)
  7. 2112503Species Escherichia coli [TaxId:562] [52677] (3 PDB entries)
  8. 2112514Domain d1g8yf_: 1g8y F: [32307]

Details for d1g8yf_

PDB Entry: 1g8y (more details), 2.4 Å

PDB Description: crystal structure of the hexameric replicative helicase repa of plasmid rsf1010
PDB Compounds: (F:) regulatory protein repa

SCOPe Domain Sequences for d1g8yf_:

Sequence, based on SEQRES records: (download)

>d1g8yf_ c.37.1.11 (F:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]}
athkpinileafaaapppldyvlpnmvagtvgalvspggagksmlalqlaaqiaggpdll
evgelptgpviylpaedpptaihhrlhalgahlsaeerqavadglliqpligslpnimap
ewfdglkraaegrrlmvldtlrrfhieeenasgpmaqvigrmeaiaadtgcsivflhhas
kgaammgagdqqqasrgssvlvdnirwqsylssmtsaeaeewgvdddqrrffvrfgvska
nygapfadrwfrrhdggvlkpa

Sequence, based on observed residues (ATOM records): (download)

>d1g8yf_ c.37.1.11 (F:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]}
athkpinileafaaapppldyvlpnmvagtvgalvspggagksmlalqlaaqiaggpdll
evgelptgpviylpaedpptaihhrlhalgahlsaeerqavadglliqpligslpnimap
ewfdglkraaegrrlmvldtlrrfhieeenasgpmaqvigrmeaiaadtgcsivflhhav
lvdnirwqsylssmtsaeaeewgvdddqrrffvrfgvskanygapfadrwfrrhdggvlk
pa

SCOPe Domain Coordinates for d1g8yf_:

Click to download the PDB-style file with coordinates for d1g8yf_.
(The format of our PDB-style files is described here.)

Timeline for d1g8yf_: