Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) |
Family d.15.4.0: automated matches [191632] (1 protein) not a true family |
Protein automated matches [191164] (24 species) not a true protein |
Species Potato (Solanum tuberosum) [TaxId:4113] [322091] (1 PDB entry) |
Domain d4zhpa1: 4zhp A:2-98 [322092] Other proteins in same PDB: d4zhpa2 automated match to d1offa_ complexed with fes |
PDB Entry: 4zhp (more details), 2.46 Å
SCOPe Domain Sequences for d4zhpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zhpa1 d.15.4.0 (A:2-98) automated matches {Potato (Solanum tuberosum) [TaxId: 4113]} asykvklitpdgpiefecpddvyildqaeeeghdlpyscragscsscagkvtagtvdqsd gkfldddqeaagfvltcvaypkcdvtiethkeeelta
Timeline for d4zhpa1: