SCOPe 2.08: Domain d4zhpa1: 4zhp A:2-98

Lineage for d4zhpa1 (4zhp A:2-98)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.0: automated matches [191632] (1 protein)
   not a true family

6. Protein automated matches [191164] (24 species)
   not a true protein

7. Species Potato (Solanum tuberosum) [TaxId:4113] [322091] (1 PDB entry)

8. Domain d4zhpa1: 4zhp A:2-98 [322092]
   Other proteins in same PDB: d4zhpa2
   automated match to d1offa_
   complexed with fes

Details for d4zhpa1

PDB Entry: 4zhp, 2.46 Å

PDB Description: the crystal structure of potato ferredoxin i with 2fe-2s cluster

PDB Compounds: (A:) Potato Ferredoxin I

SCOPe Domain Sequences for d4zhpa1:

Sequence; same for both SEQRES and ATOM records:

>d4zhpa1 d.15.4.0 (A:2-98) automated matches {Potato (Solanum tuberosum) [TaxId: 4113]}
asykvklitpdgpiefecpddvyildqaeeeghdlpyscragscsscagkvtagtvdqsd
gkfldddqeaagfvltcvaypkcdvtiethkeeelta

Timeline for d4zhpa1:

• d4zhpa1 first appeared in SCOPe 2.06
  
• d4zhpa1 appears in SCOPe 2.07