PDB entry 4zhp

View 4zhp on RCSB PDB site
Description: The crystal structure of Potato ferredoxin I with 2Fe-2S cluster
Class: electron transport
Keywords: Ferredoxin 2Fe-2S cluster Electron Transfer Chloroplast, electron transport
Deposited on 2015-04-26, released 2016-08-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-11-09, with a file datestamp of 2016-11-04.
Experiment type: XRAY
Resolution: 2.46 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Potato Ferredoxin I
    Species: Solanum tuberosum [TaxId:4113]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93XJ9 (Start-97)
      • expression tag (98)
    Domains in SCOPe 2.08: d4zhpa1, d4zhpa2
  • Heterogens: FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4zhpA (A:)
masykvklitpdgpiefecpddvyildqaeeeghdlpyscragscsscagkvtagtvdqs
dgkfldddqeaagfvltcvaypkcdvtiethkeeeltalehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >4zhpA (A:)
asykvklitpdgpiefecpddvyildqaeeeghdlpyscragscsscagkvtagtvdqsd
gkfldddqeaagfvltcvaypkcdvtiethkeeeltal