Lineage for d4zhpa1 (4zhp A:2-98)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2179170Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2179555Family d.15.4.0: automated matches [191632] (1 protein)
    not a true family
  6. 2179556Protein automated matches [191164] (21 species)
    not a true protein
  7. 2179644Species Solanum tuberosum [TaxId:4113] [322091] (1 PDB entry)
  8. 2179645Domain d4zhpa1: 4zhp A:2-98 [322092]
    Other proteins in same PDB: d4zhpa2
    automated match to d1offa_
    complexed with fes

Details for d4zhpa1

PDB Entry: 4zhp (more details), 2.46 Å

PDB Description: the crystal structure of potato ferredoxin i with 2fe-2s cluster
PDB Compounds: (A:) Potato Ferredoxin I

SCOPe Domain Sequences for d4zhpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zhpa1 d.15.4.0 (A:2-98) automated matches {Solanum tuberosum [TaxId: 4113]}
asykvklitpdgpiefecpddvyildqaeeeghdlpyscragscsscagkvtagtvdqsd
gkfldddqeaagfvltcvaypkcdvtiethkeeelta

SCOPe Domain Coordinates for d4zhpa1:

Click to download the PDB-style file with coordinates for d4zhpa1.
(The format of our PDB-style files is described here.)

Timeline for d4zhpa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4zhpa2