Lineage for d1dfka2 (1dfk A:6-28,A:77-835)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2111568Family c.37.1.9: Motor proteins [52641] (5 protein domains)
  6. 2111652Protein Myosin S1, motor domain [52642] (5 species)
    common fold is interrupted with some all-alpha subdomains
  7. 2111653Species Bay scallop (Aequipecten irradians) [TaxId:31199] [52644] (11 PDB entries)
    Uniprot P24733 3-836 ! Uniprot P24733 6-837
  8. 2111665Domain d1dfka2: 1dfk A:6-28,A:77-835 [32170]
    Other proteins in same PDB: d1dfka1, d1dfky_, d1dfkz_
    complexed with ca

Details for d1dfka2

PDB Entry: 1dfk (more details), 4.2 Å

PDB Description: nucleotide-free scallop myosin s1-near rigor state
PDB Compounds: (A:) myosin head

SCOPe Domain Sequences for d1dfka2:

Sequence, based on SEQRES records: (download)

>d1dfka2 c.37.1.9 (A:6-28,A:77-835) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}
sdpdfqylavdrkklmkeqtaafXmnppkfekledmanmtylneasvlynlrsrytsgli
ytysglfciavnpyrrlpiytdsviakyrgkrkteipphlfsvadnayqnmvtdrenqsc
litgesgagktentkkvimylakvacavkkkdeeasdkkegsledqiiqanpvleaygna
kttrnnnssrfgkfirihfgptgkiagadietylleksrvtyqqsaernyhifyqicsna
ipelndvmlvtpdsglysfinqgcltvdniddveefklcdeafdilgftkeekqsmfkct
asilhmgemkfkqrpreeqaesdgtaeaekvaflcginagdllkallkpkvkvgtemvtk
gqnmnqvvnsvgalakslydrmfnwlvrrvnktldtkakrnyyigvldiagfeifdfnsf
eqlcinytnerlqqffnhhmfileqeeykkegiawefidfgmdlqmcidliekpmgilsi
leeecmfpkaddksfqdklyqnhmgknrmftkpgkptrpnqgpahfelhhyagnvpysit
gwleknkdpinenvvallgaskeplvaelfkapeepagggkkkkgkssafqtisavhres
lnklmknlysthphfvrciipnelkqpglvdaelvlhqlqcngvlegiricrkgfpsrli
ysefkqrysilapnaipqgfvdgktvsekilaglqmdpaeyrlgttkvffkagvlgnlee
mrderlskiismfqahirgylirkaykklqdqriglsviqrnirkwlvlrnwqwwklysk
vkp

Sequence, based on observed residues (ATOM records): (download)

>d1dfka2 c.37.1.9 (A:6-28,A:77-835) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}
sdpdfqylavdfXmnppkfekledmanmtylneasvlynlrsrytsgliytysglfciav
npyrrlpiytdsviakyrgkrkteipphlfsvadnayqnmvtdrenqsclitgesgagkt
entkkvimylakvedqiiqanpvleaygrfgkfirihfgptgkiagadietylleksrvt
yqqsaipelndvmlvtpdsglysfinqgcltvdniddveefklcdeafdilgftkeekqs
mfkctasilhmgemkfkaesdgtaeaekvaflcginagdllkallkpkmnqvvnsvgala
kslydrmfnwlvrrvnktldtkakrnyyigvldiagfeifdfnsfeqlcinytnerlqqf
fnhhmfileqeeykkegiawefidfgmdlqmcidliekpmgilsileeecmfpkaddksf
qdklyqnhmgknrmftkpgkpnqgpahfelhhyagnvpysitgwleknkdpinenvvall
gaskeplvaelfkatisavhreslnklmknlysthphfvrciipnelkqpglvdaelvlh
qlqcngvlegiricrkgfpsrliysefkqrysilapnaipgktvsekilaglqmdpaeyr
lgttkvffkagvlgnleemrderlskiismfqahirgylirkaykklqdqriglsviqrn
irkwlvlrnwqwwklyskvkp

SCOPe Domain Coordinates for d1dfka2:

Click to download the PDB-style file with coordinates for d1dfka2.
(The format of our PDB-style files is described here.)

Timeline for d1dfka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dfka1