Lineage for d1dfka1 (1dfk A:29-76)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2783669Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (2 families) (S)
  5. 2783670Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)
  6. 2783671Protein Myosin S1 fragment, N-terminal domain [50086] (4 species)
  7. 2783672Species Bay scallop (Aequipecten irradians) [TaxId:31199] [50088] (11 PDB entries)
    Uniprot P24733 3-836 ! Uniprot P24733 6-837
  8. 2783682Domain d1dfka1: 1dfk A:29-76 [24573]
    Other proteins in same PDB: d1dfka2, d1dfky_, d1dfkz_
    complexed with ca

Details for d1dfka1

PDB Entry: 1dfk (more details), 4.2 Å

PDB Description: nucleotide-free scallop myosin s1-near rigor state
PDB Compounds: (A:) myosin head

SCOPe Domain Sequences for d1dfka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dfka1 b.34.3.1 (A:29-76) Myosin S1 fragment, N-terminal domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}
dgkkncwvpdekegfasaeiqsskgdeitvkivadsstrtvkkddiqs

SCOPe Domain Coordinates for d1dfka1:

Click to download the PDB-style file with coordinates for d1dfka1.
(The format of our PDB-style files is described here.)

Timeline for d1dfka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dfka2