| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (2 families) ![]() |
| Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein) |
| Protein Myosin S1 fragment, N-terminal domain [50086] (4 species) |
| Species Bay scallop (Aequipecten irradians) [TaxId:31199] [50088] (11 PDB entries) Uniprot P24733 3-836 ! Uniprot P24733 6-837 |
| Domain d1dfka1: 1dfk A:29-76 [24573] Other proteins in same PDB: d1dfka2, d1dfky_, d1dfkz_ complexed with ca |
PDB Entry: 1dfk (more details), 4.2 Å
SCOPe Domain Sequences for d1dfka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dfka1 b.34.3.1 (A:29-76) Myosin S1 fragment, N-terminal domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}
dgkkncwvpdekegfasaeiqsskgdeitvkivadsstrtvkkddiqs
Timeline for d1dfka1: