![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
![]() | Protein Myosin Regulatory Chain [47527] (2 species) |
![]() | Species Bay scallop (Aequipecten irradians) [TaxId:31199] [47528] (15 PDB entries) Uniprot P07291 |
![]() | Domain d1dfkz_: 1dfk Z: [17320] Other proteins in same PDB: d1dfka1, d1dfka2, d1dfky_ complexed with ca |
PDB Entry: 1dfk (more details), 4.2 Å
SCOPe Domain Sequences for d1dfkz_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dfkz_ a.39.1.5 (Z:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} lsqdeiddlkdvfelfdfwdgrdgavdafklgdvcrclginprnedvfavggthkmgeks lpfeeflpayeglmdceqgtfadymeafktfdregqgfisgaelrhvltalgerlsdedv deiikltdlqedlegnvkyedfvkkvmagpyp
Timeline for d1dfkz_: