SCOPe 2.08: Domain d5j2uf1: 5j2u F:1-76

Lineage for d5j2uf1 (5j2u F:1-76)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.0: automated matches [227183] (1 protein)
   not a true family

6. Protein automated matches [226903] (40 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [321364] (1 PDB entry)

8. Domain d5j2uf1: 5j2u F:1-76 [321365]
   Other proteins in same PDB: d5j2ua1, d5j2ua2, d5j2ub1, d5j2ub2, d5j2uc1, d5j2uc2, d5j2ud1, d5j2ud2, d5j2ue_, d5j2uf2
   automated match to d3tiia1
   complexed with 6do, acp, ca, gdp, gtp, mg

Details for d5j2uf1

PDB Entry: 5j2u, 2.5 Å

PDB Description: tubulin-mmaf complex

PDB Compounds: (F:) Tubulin beta-2B chain

SCOPe Domain Sequences for d5j2uf1:

Sequence; same for both SEQRES and ATOM records:

>d5j2uf1 c.30.1.0 (F:1-76) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq
lvnyyrgadklcrkas

Timeline for d5j2uf1:

• d5j2uf1 first appeared in SCOPe 2.06
  
• d5j2uf1 appears in SCOPe 2.07