Lineage for d5j2ue_ (5j2u E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2339505Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2339704Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
    automatically mapped to Pfam PF00836
  5. 2339705Family a.137.10.1: Stathmin [101495] (2 protein domains)
  6. 2339706Protein Stathmin 4 [101496] (2 species)
  7. 2339707Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (87 PDB entries)
  8. 2339757Domain d5j2ue_: 5j2u E: [321374]
    Other proteins in same PDB: d5j2ua1, d5j2ua2, d5j2ub1, d5j2ub2, d5j2uc1, d5j2uc2, d5j2ud1, d5j2ud2, d5j2uf1, d5j2uf2
    automated match to d4i55e_
    complexed with 6do, acp, ca, gdp, gtp, mg

Details for d5j2ue_

PDB Entry: 5j2u (more details), 2.5 Å

PDB Description: tubulin-mmaf complex
PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d5j2ue_:

Sequence, based on SEQRES records: (download)

>d5j2ue_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelkeea

Sequence, based on observed residues (ATOM records): (download)

>d5j2ue_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
eea

SCOPe Domain Coordinates for d5j2ue_:

Click to download the PDB-style file with coordinates for d5j2ue_.
(The format of our PDB-style files is described here.)

Timeline for d5j2ue_: