Lineage for d5j2uf1 (5j2u F:1-76)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2120504Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2120505Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2120847Family c.30.1.0: automated matches [227183] (1 protein)
    not a true family
  6. 2120848Protein automated matches [226903] (35 species)
    not a true protein
  7. 2120867Species Bos taurus [TaxId:9913] [321364] (1 PDB entry)
  8. 2120868Domain d5j2uf1: 5j2u F:1-76 [321365]
    Other proteins in same PDB: d5j2ua1, d5j2ua2, d5j2ub1, d5j2ub2, d5j2uc1, d5j2uc2, d5j2ud1, d5j2ud2, d5j2ue_, d5j2uf2
    automated match to d3tiia1
    complexed with 6do, acp, ca, gdp, gtp, mg

Details for d5j2uf1

PDB Entry: 5j2u (more details), 2.5 Å

PDB Description: tubulin-mmaf complex
PDB Compounds: (F:) Tubulin beta-2B chain

SCOPe Domain Sequences for d5j2uf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j2uf1 c.30.1.0 (F:1-76) automated matches {Bos taurus [TaxId: 9913]}
mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq
lvnyyrgadklcrkas

SCOPe Domain Coordinates for d5j2uf1:

Click to download the PDB-style file with coordinates for d5j2uf1.
(The format of our PDB-style files is described here.)

Timeline for d5j2uf1: