SCOPe 2.08: Domain d5dmxf1: 5dmx F:1-98

Lineage for d5dmxf1 (5dmx F:1-98)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.0: automated matches [227183] (1 protein)
   not a true family

6. Protein automated matches [226903] (40 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:405416] [321244] (2 PDB entries)

8. Domain d5dmxf1: 5dmx F:1-98 [321348]
   Other proteins in same PDB: d5dmxa2, d5dmxb2, d5dmxc2, d5dmxd2, d5dmxe2, d5dmxf2
   automated match to d4egjd1

Details for d5dmxf1

PDB Entry: 5dmx, 2.81 Å

PDB Description: crystal structure of d-alanine-d-alanine ligase from acinetobacter baumannii, space group p212121

PDB Compounds: (F:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d5dmxf1:

Sequence; same for both SEQRES and ATOM records:

>d5dmxf1 c.30.1.0 (F:1-98) automated matches {Acinetobacter baumannii [TaxId: 405416]}
msnatkfgkvavllggksaeravsldsgqavldallrsgvqaeafdpqdrsvtelvnydr
afivlhgrggedgqiqgvlewlnipytgtgvqgsaigm

Timeline for d5dmxf1:

• d5dmxf1 first appeared in SCOPe 2.06
  
• d5dmxf1 appears in SCOPe 2.07