Lineage for d5dmxf1 (5dmx F:1-98)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2861871Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2861872Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2862338Family c.30.1.0: automated matches [227183] (1 protein)
    not a true family
  6. 2862339Protein automated matches [226903] (40 species)
    not a true protein
  7. 2862340Species Acinetobacter baumannii [TaxId:405416] [321244] (2 PDB entries)
  8. 2862352Domain d5dmxf1: 5dmx F:1-98 [321348]
    Other proteins in same PDB: d5dmxa2, d5dmxb2, d5dmxc2, d5dmxd2, d5dmxe2, d5dmxf2
    automated match to d4egjd1

Details for d5dmxf1

PDB Entry: 5dmx (more details), 2.81 Å

PDB Description: crystal structure of d-alanine-d-alanine ligase from acinetobacter baumannii, space group p212121
PDB Compounds: (F:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d5dmxf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dmxf1 c.30.1.0 (F:1-98) automated matches {Acinetobacter baumannii [TaxId: 405416]}
msnatkfgkvavllggksaeravsldsgqavldallrsgvqaeafdpqdrsvtelvnydr
afivlhgrggedgqiqgvlewlnipytgtgvqgsaigm

SCOPe Domain Coordinates for d5dmxf1:

Click to download the PDB-style file with coordinates for d5dmxf1.
(The format of our PDB-style files is described here.)

Timeline for d5dmxf1: