Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) |
Family d.142.1.0: automated matches [227184] (1 protein) not a true family |
Protein automated matches [226904] (39 species) not a true protein |
Species Acinetobacter baumannii [TaxId:405416] [321246] (2 PDB entries) |
Domain d5dmxb2: 5dmx B:99-305 [344198] Other proteins in same PDB: d5dmxa1, d5dmxb1, d5dmxc1, d5dmxd1, d5dmxe1, d5dmxf1 |
PDB Entry: 5dmx (more details), 2.81 Å
SCOPe Domain Sequences for d5dmxb2:
Sequence, based on SEQRES records: (download)
>d5dmxb2 d.142.1.0 (B:99-305) automated matches {Acinetobacter baumannii [TaxId: 405416]} dkvktkqiwqgsdlptapyriitketdldsviaelglpviikpvhegssvgmskvekaed faaaiekatqhdavvmaekwitgreftisflngqplpvirlqppadvafydyeakyqrnd veygipcglseteekklqalclrafqavgaegwgridamqdeqgnfwllevntvpgmtsh slvpkaakavgysfdelcvaileqtle
>d5dmxb2 d.142.1.0 (B:99-305) automated matches {Acinetobacter baumannii [TaxId: 405416]} dkvktkqiwqgsdlptapyriitketdldsviaelglpviikpvhegavvmaekwitgre ftisflngqplpvirlqygipcglseteekklqalclrafqavgaegwgridamqdeqgn fwllevntvpgmtshslvpkaakavgysfdelcvaileqtle
Timeline for d5dmxb2: