SCOP 1.55: Domain d1tnda2: 1tnd A:27-56,A:178-349

Lineage for d1tnda2 (1tnd A:27-56,A:178-349)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families)

5. Family c.37.1.8: G proteins [52592] (20 proteins)

6. Protein Transducin (alpha subunit) [52623] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [52624] (11 PDB entries)

8. Domain d1tnda2: 1tnd A:27-56,A:178-349 [32081]
   Other proteins in same PDB: d1tnda1, d1tndb1, d1tndc1

Details for d1tnda2

PDB Entry: 1tnd, 2.2 Å

PDB Description: the 2.2 angstroms crystal structure of transducin-alpha complexed with gtp gamma s

SCOP Domain Sequences for d1tnda2:

Sequence; same for both SEQRES and ATOM records:

>d1tnda2 c.37.1.8 (A:27-56,A:178-349) Transducin (alpha subunit) {Cow (Bos taurus)}
artvkllllgagesgkstivkqmkiihqdgXtgiietqfsfkdlnfrmfdvggqrserkk
wihcfegvtciifiaalsaydmvlveddevnrmheslhlfnsicnhryfattsivlflnk
kdvfsekikkahlsicfpdyngpntyedagnyikvqflelnmrrdvkeiyshmtcatdtq
nvkfvfdavtdiiikenlkdcgl

Timeline for d1tnda2:

• d1tnda2 appears in SCOP 1.57
  
• d1tnda2 appears in the current release, SCOPe 2.08