Lineage for d1eesa_ (1ees A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2447791Family c.37.1.8: G proteins [52592] (80 protein domains)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2447883Protein CDC42 [52619] (2 species)
  7. 2447884Species Human (Homo sapiens) [TaxId:9606] [52620] (30 PDB entries)
  8. 2447924Domain d1eesa_: 1ees A: [32073]
    Other proteins in same PDB: d1eesb_

Details for d1eesa_

PDB Entry: 1ees (more details)

PDB Description: solution structure of cdc42hs complexed with a peptide derived from p-21 activated kinase, nmr, 20 structures
PDB Compounds: (A:) GTP-binding protein

SCOPe Domain Sequences for d1eesa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eesa_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]}
mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaale

SCOPe Domain Coordinates for d1eesa_:

Click to download the PDB-style file with coordinates for d1eesa_.
(The format of our PDB-style files is described here.)

Timeline for d1eesa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1eesb_