PDB entry 1ees

View 1ees on RCSB PDB site
Description: solution structure of cdc42hs complexed with a peptide derived from p-21 activated kinase, nmr, 20 structures
Class: structural protein
Keywords: protein-protein complex, STRUCTURAL PROTEIN
Deposited on 2000-02-02, released 2000-03-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP-binding protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1eesa_
  • Chain 'B':
    Compound: p21-activated kinase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q61036 (0-45)
      • see remark 999 (0-1)
    Domains in SCOPe 2.08: d1eesb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1eesA (A:)
mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaale

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1eesB (B:)
gskerpeislpsdfehtihvgfdavtgeftgipeqwarllqtsnit