Lineage for d1e0sa_ (1e0s A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) 
Family c.37.1.8: G proteins [52592] (20 proteins) 
Protein ADP-ribosylation factor [52614] (4 species) 
Species Human (Homo sapiens), ARF6 [TaxId:9606] [52617] (2 PDB entries) 
Domain d1e0sa_: 1e0s A: [32057]
Details for d1e0sa_
PDB Entry: 1e0s (more details), 2.28 Å
PDB Description: small g protein arf6-gdp
SCOP Domain Sequences for d1e0sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6}
gkvlskifgnkemrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfnv
wdvggqdkirplwrhyytgtqglifvvdcadrdridearqelhriindremrdaiilifa
nkqdlpdamkpheiqeklgltrirdrnwyvqpscatsgdglyegltwltsnyk
SCOP Domain Coordinates for d1e0sa_:
Click to download the PDB-style file with coordinates for d1e0sa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1e0sa_:
- d1e0sa_ appears in SCOP 1.57
- d1e0sa_ appears in the current release, SCOPe 2.08
View in 3D