Lineage for d5exbd1 (5exb D:3-225)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546826Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2546827Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2547682Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2547683Protein automated matches [190526] (25 species)
    not a true protein
  7. 2547805Species Dendronephthya sp. [TaxId:51110] [320282] (1 PDB entry)
  8. 2547809Domain d5exbd1: 5exb D:3-225 [320525]
    Other proteins in same PDB: d5exbb2, d5exbc2, d5exbd2, d5exbg2, d5exbk2, d5exbl2
    automated match to d3svna_
    complexed with gol

Details for d5exbd1

PDB Entry: 5exb (more details), 1.81 Å

PDB Description: wild type green fluorescent protein dendfp (dendronephthya sp.)
PDB Compounds: (D:) Green fluorescent protein

SCOPe Domain Sequences for d5exbd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5exbd1 d.22.1.0 (D:3-225) automated matches {Dendronephthya sp. [TaxId: 51110]}
likedmrvkvhmegnvnghafviegegkgkpyegtqtlnltvkegaplpfsydilttalx
nrvftkypedipdyfkqsfpegyswertmtyedkgictirsdislegdcffqnvrfngmn
fppngpvmqkktlkwepsteklhvrdgllvgninmallleggghylcdfkttykakkvvq
lpdyhfvdhrieilsndsdynkvklyehgvarysplpsqaw

SCOPe Domain Coordinates for d5exbd1:

Click to download the PDB-style file with coordinates for d5exbd1.
(The format of our PDB-style files is described here.)

Timeline for d5exbd1: