![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
![]() | Superfamily d.22.1: GFP-like [54511] (3 families) ![]() |
![]() | Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
![]() | Protein automated matches [190526] (25 species) not a true protein |
![]() | Species Dendronephthya sp. [TaxId:51110] [320282] (1 PDB entry) |
![]() | Domain d5exbc1: 5exb C:3-225 [320439] Other proteins in same PDB: d5exbb2, d5exbc2, d5exbd2, d5exbg2, d5exbk2, d5exbl2 automated match to d3svna_ complexed with gol |
PDB Entry: 5exb (more details), 1.81 Å
SCOPe Domain Sequences for d5exbc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5exbc1 d.22.1.0 (C:3-225) automated matches {Dendronephthya sp. [TaxId: 51110]} likedmrvkvhmegnvnghafviegegkgkpyegtqtlnltvkegaplpfsydilttalx nrvftkypedipdyfkqsfpegyswertmtyedkgictirsdislegdcffqnvrfngmn fppngpvmqkktlkwepsteklhvrdgllvgninmallleggghylcdfkttykakkvvq lpdyhfvdhrieilsndsdynkvklyehgvarysplpsqaw
Timeline for d5exbc1: