SCOPe 2.07: Domain d5exbl1: 5exb L:3-225

Lineage for d5exbl1 (5exb L:3-225)

Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
Fold d.22: GFP-like [54510] (1 superfamily)
beta-sheet folds into a barrel (n=11, S=14) around the central helix
Superfamily d.22.1: GFP-like [54511] (3 families)
Family d.22.1.0: automated matches [191400] (1 protein)
not a true family
Protein automated matches [190526] (25 species)
not a true protein
Species Dendronephthya sp. [TaxId:51110] [320282] (1 PDB entry)
Domain d5exbl1: 5exb L:3-225 [320338]
Other proteins in same PDB: d5exbb2, d5exbc2, d5exbd2, d5exbg2, d5exbk2, d5exbl2
automated match to d3svna_
complexed with gol

Details for d5exbl1

PDB Entry: 5exb (more details), 1.81 Å

PDB Description: wild type green fluorescent protein dendfp (dendronephthya sp.)

PDB Compounds: (L:) Green fluorescent protein

SCOPe Domain Sequences for d5exbl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5exbl1 d.22.1.0 (L:3-225) automated matches {Dendronephthya sp. [TaxId: 51110]}
likedmrvkvhmegnvnghafviegegkgkpyegtqtlnltvkegaplpfsydilttalx
nrvftkypedipdyfkqsfpegyswertmtyedkgictirsdislegdcffqnvrfngmn
fppngpvmqkktlkwepsteklhvrdgllvgninmallleggghylcdfkttykakkvvq
lpdyhfvdhrieilsndsdynkvklyehgvarysplpsqaw

SCOPe Domain Coordinates for d5exbl1:

Click to download the PDB-style file with coordinates for d5exbl1.
(The format of our PDB-style files is described here.)

Timeline for d5exbl1: