![]() | Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
![]() | Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (20 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (31 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein RhoA [52612] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [52613] (7 PDB entries) |
![]() | Domain d1cc0a_: 1cc0 A: [32050] Other proteins in same PDB: d1cc0e_, d1cc0f_ |
PDB Entry: 1cc0 (more details), 5 Å
SCOP Domain Sequences for d1cc0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cc0a_ c.37.1.8 (A:) RhoA {Human (Homo sapiens)} irkklvivgdgacgktcllivnskdqfpevyvptvfenyvadievdgkqvelalwdtagq edydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlrn dehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalqarr gkkksgc
Timeline for d1cc0a_: