Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) |
Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) |
Family c.37.1.8: G proteins [52592] (26 proteins) |
Protein RhoA [52612] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [52613] (7 PDB entries) |
Domain d1cc0a_: 1cc0 A: [32050] Other proteins in same PDB: d1cc0e_, d1cc0f_ |
PDB Entry: 1cc0 (more details), 5 Å
SCOP Domain Sequences for d1cc0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cc0a_ c.37.1.8 (A:) RhoA {Human (Homo sapiens)} irkklvivgdgacgktcllivnskdqfpevyvptvfenyvadievdgkqvelalwdtagq edydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlrn dehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalqarr gkkksgc
Timeline for d1cc0a_: