Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
Protein automated matches [190332] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187155] (29 PDB entries) |
Domain d5im0a_: 5im0 A: [320430] Other proteins in same PDB: d5im0b2, d5im0b3 automated match to d3s7ra_ |
PDB Entry: 5im0 (more details), 1.7 Å
SCOPe Domain Sequences for d5im0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5im0a_ d.58.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} megkmfigglswdttkkdlkdyfskfgevvdctlkldpitgrsrgfgfvlfkesesvdkv mdqkehklngkvidpkrak
Timeline for d5im0a_: