PDB entry 5im0

View 5im0 on RCSB PDB site
Description: Crystal structure of the RNA recognition motif of mRNA decay regulator AUF1
Class: RNA binding protein
Keywords: mRNA decay, hnRNP D0, AUF1, RNA recognition motif, crystallization, RNA BINDING PROTEIN
Deposited on 2016-03-05, released 2016-08-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-08-03, with a file datestamp of 2016-07-29.
Experiment type: XRAY
Resolution: 1.7000000000000002 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heterogeneous nuclear ribonucleoprotein D0
    Species: Homo sapiens [TaxId:9606]
    Gene: HNRNPD, AUF1, HNRPD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5im0a_
  • Chain 'B':
    Compound: heterogeneous nuclear ribonucleoprotein D0
    Species: Homo sapiens [TaxId:9606]
    Gene: HNRNPD, AUF1, HNRPD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14103 (1-80)
      • expression tag (0)
      • expression tag (81)
    Domains in SCOPe 2.08: d5im0b1, d5im0b2, d5im0b3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5im0A (A:)
    mskneemegkmfigglswdttkkdlkdyfskfgevvdctlkldpitgrsrgfgfvlfkes
    esvdkvmdqkehklngkvidpkrakam
    

    Sequence, based on observed residues (ATOM records): (download)
    >5im0A (A:)
    megkmfigglswdttkkdlkdyfskfgevvdctlkldpitgrsrgfgfvlfkesesvdkv
    mdqkehklngkvidpkrak
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5im0B (B:)
    megkmfigglswdttkkdlkdyfskfgevvdctlkldpitgrsrgfgfvlfkesesvdkv
    mdqkehklngkvidpkrakama