Lineage for d5jvmb1 (5jvm B:3-79)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2351135Fold a.245: EB1 dimerisation domain-like [140611] (1 superfamily)
    dimeric 4-helical bundle with a coiled coil at one end formed by the longer N-terminal helices
  4. 2351136Superfamily a.245.1: EB1 dimerisation domain-like [140612] (1 family) (S)
  5. 2351137Family a.245.1.1: EB1 dimerisation domain-like [140613] (2 proteins)
    Pfam PF03271
  6. 2351138Protein Microtubule-associated protein EB1, C-terminal dimerization domain [140614] (3 species)
  7. 2351139Species Human (Homo sapiens) [TaxId:9606] [140615] (12 PDB entries)
    Uniprot Q15691 189-249! Uniprot Q15691 189-254! Uniprot Q15691 190-248! Uniprot Q15691 191-254
  8. 2351146Domain d5jvmb1: 5jvm B:3-79 [320402]
    Other proteins in same PDB: d5jvma2, d5jvmb2
    automated match to d1wu9b_
    complexed with mg

Details for d5jvmb1

PDB Entry: 5jvm (more details), 1.57 Å

PDB Description: the neck-linker and alpha 7 helix of mus musculus kif3c
PDB Compounds: (B:) Chimera protein of Kinesin-like protein KIF3C and Microtubule-associated protein RP/EB family member 1

SCOPe Domain Sequences for d5jvmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jvmb1 a.245.1.1 (B:3-79) Microtubule-associated protein EB1, C-terminal dimerization domain {Human (Homo sapiens) [TaxId: 9606]}
nedpkdtllrefqeeiarlkaqlekkgmlvedlekerdfyfgklrnielicqenegendp
vlqrivdilyatdegfv

SCOPe Domain Coordinates for d5jvmb1:

Click to download the PDB-style file with coordinates for d5jvmb1.
(The format of our PDB-style files is described here.)

Timeline for d5jvmb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5jvmb2