SCOPe 2.06: Domain d5jvmb1: 5jvm B:3-79

Lineage for d5jvmb1 (5jvm B:3-79)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.245: EB1 dimerisation domain-like [140611] (1 superfamily)
   dimeric 4-helical bundle with a coiled coil at one end formed by the longer N-terminal helices

4. Superfamily a.245.1: EB1 dimerisation domain-like [140612] (1 family)

5. Family a.245.1.1: EB1 dimerisation domain-like [140613] (2 proteins)
   Pfam PF03271

6. Protein Microtubule-associated protein EB1, C-terminal dimerization domain [140614] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140615] (10 PDB entries)
   Uniprot Q15691 189-249! Uniprot Q15691 189-254! Uniprot Q15691 190-248! Uniprot Q15691 191-254

8. Domain d5jvmb1: 5jvm B:3-79 [320402]
   Other proteins in same PDB: d5jvma2, d5jvmb2
   automated match to d1wu9b_
   complexed with mg

Details for d5jvmb1

PDB Entry: 5jvm, 1.57 Å

PDB Description: the neck-linker and alpha 7 helix of mus musculus kif3c

PDB Compounds: (B:) Chimera protein of Kinesin-like protein KIF3C and Microtubule-associated protein RP/EB family member 1

SCOPe Domain Sequences for d5jvmb1:

Sequence; same for both SEQRES and ATOM records:

>d5jvmb1 a.245.1.1 (B:3-79) Microtubule-associated protein EB1, C-terminal dimerization domain {Human (Homo sapiens) [TaxId: 9606]}
nedpkdtllrefqeeiarlkaqlekkgmlvedlekerdfyfgklrnielicqenegendp
vlqrivdilyatdegfv

Timeline for d5jvmb1:

• d5jvmb1 is new in SCOPe 2.06-stable
  
• d5jvmb1 appears in SCOPe 2.07
  
• d5jvmb1 appears in the current release, SCOPe 2.08