Lineage for d1wu9b_ (1wu9 B:)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.245: EB1 dimerisation domain-like [140611] (1 superfamily)
dimeric 4-helical bundle with a coiled coil at one end formed by the longer N-terminal helicesSuperfamily a.245.1: EB1 dimerisation domain-like [140612] (1 family) 
Family a.245.1.1: EB1 dimerisation domain-like [140613] (2 proteins)
Pfam PF03271Protein Microtubule-associated protein EB1, C-terminal dimerization domain [140614] (3 species) Species Human (Homo sapiens) [TaxId:9606] [140615] (12 PDB entries)
Uniprot Q15691 189-249! Uniprot Q15691 189-254! Uniprot Q15691 190-248! Uniprot Q15691 191-254
Domain d1wu9b_: 1wu9 B: [121280]
automated match to d1yiga1
Details for d1wu9b_
PDB Entry: 1wu9 (more details), 1.54 Å
PDB Description: crystal structure of the c-terminal domain of the end-binding protein 1 (eb1)
PDB Compounds: (B:) Microtubule-associated protein RP/EB family member 1SCOPe Domain Sequences for d1wu9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wu9b_ a.245.1.1 (B:) Microtubule-associated protein EB1, C-terminal dimerization domain {Human (Homo sapiens) [TaxId: 9606]}
deaaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilyatd
egfvipd
SCOPe Domain Coordinates for d1wu9b_:
Click to download the PDB-style file with coordinates for d1wu9b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wu9b_:
- d1wu9b_ first appeared in SCOP 1.73, called d1wu9b1
- d1wu9b_ appears in SCOPe 2.06
- d1wu9b_ appears in the current release, SCOPe 2.08
View in 3D
