![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) ![]() |
![]() | Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
![]() | Protein Tubulin beta-subunit [55313] (2 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [55314] (9 PDB entries) |
![]() | Domain d4zi7b2: 4zi7 B:246-440 [320164] Other proteins in same PDB: d4zi7a1, d4zi7a2, d4zi7b1, d4zi7c1, d4zi7c2, d4zi7d1, d4zi7e_, d4zi7f1, d4zi7f2, d4zi7f3 automated match to d1sa0b2 complexed with 4sl, acp, ca, gdp, gol, gtp, mes, mg |
PDB Entry: 4zi7 (more details), 2.51 Å
SCOPe Domain Sequences for d4zi7b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zi7b2 d.79.2.1 (B:246-440) Tubulin beta-subunit {Pig (Sus scrofa) [TaxId: 9823]} gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdaknmmaac dprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq qyqdata
Timeline for d4zi7b2: