Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) |
Family d.142.1.10: Tubulin tyrosine ligase (TTL) C-terminal domain-like [310626] (2 proteins) Pfam PF03133; PubMed 22020298 |
Protein Tubulin tyrosine ligase (TTL) C-terminal domain [310728] (3 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [311385] (176 PDB entries) |
Domain d4zi7f2: 4zi7 F:77-378 [320175] Other proteins in same PDB: d4zi7a1, d4zi7a2, d4zi7b1, d4zi7b2, d4zi7c1, d4zi7c2, d4zi7d1, d4zi7d2, d4zi7e_, d4zi7f1, d4zi7f3 automated match to d3tiia2 complexed with 4sl, acp, ca, gdp, gol, gtp, mes, mg |
PDB Entry: 4zi7 (more details), 2.51 Å
SCOPe Domain Sequences for d4zi7f2:
Sequence, based on SEQRES records: (download)
>d4zi7f2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} lvkliktspelsesctwfpesyviyptnlktpvapaqngirhlinntrtderevflaayn rrregregnvwiakssagakgegilisseaselldfideqgqvhviqkylekplllepgh rkfdirswvlvdhlyniylyregvlrtssepynsanfqdktchltnhciqkeysknygry eegnemffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfg fdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfpladtgqktsqptsifi kl
>d4zi7f2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} lvkliktspelsesctwfpesyviyptntderevflaaynrrregregnvwiakgiliss easelldfideqgqvhviqkylekplllepghrkfdirswvlvdhlyniylyregvlrts sepynsanfqdktchltnhciqkeynygryeegnemffeefnqylmdalnttlensillq ikhiirsclmciepaistkhlhyqsfqlfgfdfmvdeelkvwlievngapacaqklyael cqgivdvaissvfpladtsifikl
Timeline for d4zi7f2: