Lineage for d4zi7f1 (4zi7 F:1-76)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2444095Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2444096Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2444379Family c.30.1.9: Tubulin tyrosine ligase (TTL) N-terminal domain-like [310625] (1 protein)
  6. 2444380Protein Tubulin tyrosine ligase (TTL) N-terminal domain [310727] (2 species)
  7. 2444381Species Chicken (Gallus gallus) [TaxId:9031] [311384] (82 PDB entries)
  8. 2444422Domain d4zi7f1: 4zi7 F:1-76 [320174]
    Other proteins in same PDB: d4zi7a1, d4zi7a2, d4zi7b1, d4zi7b2, d4zi7c1, d4zi7c2, d4zi7d1, d4zi7d2, d4zi7e_, d4zi7f2, d4zi7f3
    automated match to d3tiia1
    complexed with 4sl, acp, ca, gdp, gol, gtp, mes, mg

Details for d4zi7f1

PDB Entry: 4zi7 (more details), 2.51 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-hti286 complex
PDB Compounds: (F:) Tubulin-tyrosine ligase

SCOPe Domain Sequences for d4zi7f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zi7f1 c.30.1.9 (F:1-76) Tubulin tyrosine ligase (TTL) N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq
lvnyyrgadklcrkas

SCOPe Domain Coordinates for d4zi7f1:

Click to download the PDB-style file with coordinates for d4zi7f1.
(The format of our PDB-style files is described here.)

Timeline for d4zi7f1: