Lineage for d5a4we2 (5a4w E:87-212)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998814Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1998815Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1998816Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1999457Protein automated matches [226848] (11 species)
    not a true protein
  7. 1999458Species Arabidopsis thaliana [TaxId:3702] [318877] (4 PDB entries)
  8. 1999469Domain d5a4we2: 5a4w E:87-212 [319218]
    Other proteins in same PDB: d5a4wa1, d5a4wb1, d5a4wc1, d5a4wd1, d5a4we1, d5a4wf1
    automated match to d1gnwa1
    complexed with act, qct

Details for d5a4we2

PDB Entry: 5a4w (more details), 2.25 Å

PDB Description: atgstf2 from arabidopsis thaliana in complex with quercetrin
PDB Compounds: (E:) glutathione s-transferase f2

SCOPe Domain Sequences for d5a4we2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a4we2 a.45.1.1 (E:87-212) automated matches {Arabidopsis thaliana [TaxId: 3702]}
lqtdsknisqyaimaigmqvedhqfdpvasklafeqifksiyglttdeavvaeeeaklak
vldvyearlkefkylagetftltdlhhipaiqyllgtptkklfterprvnewvaeitkrp
asekvq

SCOPe Domain Coordinates for d5a4we2:

Click to download the PDB-style file with coordinates for d5a4we2.
(The format of our PDB-style files is described here.)

Timeline for d5a4we2: