Lineage for d5a4wb1 (5a4w B:3-86)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2132062Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2132690Protein automated matches [227019] (3 species)
    not a true protein
  7. 2132691Species Arabidopsis thaliana [TaxId:3702] [318873] (4 PDB entries)
  8. 2132699Domain d5a4wb1: 5a4w B:3-86 [319186]
    Other proteins in same PDB: d5a4wa2, d5a4wb2, d5a4wc2, d5a4wd2, d5a4we2, d5a4wf2
    automated match to d1gnwa2
    complexed with act, qct

Details for d5a4wb1

PDB Entry: 5a4w (more details), 2.25 Å

PDB Description: atgstf2 from arabidopsis thaliana in complex with quercetrin
PDB Compounds: (B:) glutathione s-transferase f2

SCOPe Domain Sequences for d5a4wb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a4wb1 c.47.1.5 (B:3-86) automated matches {Arabidopsis thaliana [TaxId: 3702]}
gikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafedgd
lklfesraitqyiahryenqgtnl

SCOPe Domain Coordinates for d5a4wb1:

Click to download the PDB-style file with coordinates for d5a4wb1.
(The format of our PDB-style files is described here.)

Timeline for d5a4wb1: