SCOPe 2.06: Domain d5a4wf2: 5a4w F:87-212

Lineage for d5a4wf2 (5a4w F:87-212)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein automated matches [226848] (11 species)
   not a true protein

7. Species Arabidopsis thaliana [TaxId:3702] [318877] (4 PDB entries)

8. Domain d5a4wf2: 5a4w F:87-212 [319207]
   Other proteins in same PDB: d5a4wa1, d5a4wb1, d5a4wc1, d5a4wd1, d5a4we1, d5a4wf1
   automated match to d1gnwa1
   complexed with act, qct

Details for d5a4wf2

PDB Entry: 5a4w, 2.25 Å

PDB Description: atgstf2 from arabidopsis thaliana in complex with quercetrin

PDB Compounds: (F:) glutathione s-transferase f2

SCOPe Domain Sequences for d5a4wf2:

Sequence, based on SEQRES records:

>d5a4wf2 a.45.1.1 (F:87-212) automated matches {Arabidopsis thaliana [TaxId: 3702]}
lqtdsknisqyaimaigmqvedhqfdpvasklafeqifksiyglttdeavvaeeeaklak
vldvyearlkefkylagetftltdlhhipaiqyllgtptkklfterprvnewvaeitkrp
asekvq

Sequence, based on observed residues (ATOM records):

>d5a4wf2 a.45.1.1 (F:87-212) automated matches {Arabidopsis thaliana [TaxId: 3702]}
lqtdsknisqyaimaigmqvedhqfdpvasklafeqifksiyglvaeeeaklakvldvye
arlkefkylagetftltdlhhipaiqyllgtptkklfterprvnewvaeitkrpasekvq

Timeline for d5a4wf2:

• d5a4wf2 is new in SCOPe 2.06-stable
  
• d5a4wf2 appears in SCOPe 2.07
  
• d5a4wf2 appears in the current release, SCOPe 2.08