SCOPe 2.08: Domain d5a5kc1: 5a5k C:3-86

Lineage for d5a5kc1 (5a5k C:3-86)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein automated matches [227019] (4 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [318873] (4 PDB entries)

8. Domain d5a5kc1: 5a5k C:3-86 [318975]
   Other proteins in same PDB: d5a5ka2, d5a5kb2, d5a5kc2, d5a5kd2, d5a5ke2, d5a5kf2, d5a5kg2, d5a5kh2, d5a5ki2, d5a5kj2, d5a5kk2, d5a5kl2, d5a5km2, d5a5kn2, d5a5ko2, d5a5kp2, d5a5kq2, d5a5kr2, d5a5ks2, d5a5kt2, d5a5ku2, d5a5kv2, d5a5kw2, d5a5kx2
   automated match to d1gnwa2
   complexed with 7wb

Details for d5a5kc1

PDB Entry: 5a5k, 2.77 Å

PDB Description: atgstf2 from arabidopsis thaliana in complex with camalexin

PDB Compounds: (C:) glutathione s-transferase f2

SCOPe Domain Sequences for d5a5kc1:

Sequence; same for both SEQRES and ATOM records:

>d5a5kc1 c.47.1.5 (C:3-86) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafedgd
lklfesraitqyiahryenqgtnl

Timeline for d5a5kc1:

• d5a5kc1 first appeared in SCOPe 2.06
  
• d5a5kc1 appears in SCOPe 2.07