Lineage for d5a5ke1 (5a5k E:3-86)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876589Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2877295Protein automated matches [227019] (4 species)
    not a true protein
  7. 2877315Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [318873] (4 PDB entries)
  8. 2877338Domain d5a5ke1: 5a5k E:3-86 [319224]
    Other proteins in same PDB: d5a5ka2, d5a5kb2, d5a5kc2, d5a5kd2, d5a5ke2, d5a5kf2, d5a5kg2, d5a5kh2, d5a5ki2, d5a5kj2, d5a5kk2, d5a5kl2, d5a5km2, d5a5kn2, d5a5ko2, d5a5kp2, d5a5kq2, d5a5kr2, d5a5ks2, d5a5kt2, d5a5ku2, d5a5kv2, d5a5kw2, d5a5kx2
    automated match to d1gnwa2
    complexed with 7wb

Details for d5a5ke1

PDB Entry: 5a5k (more details), 2.77 Å

PDB Description: atgstf2 from arabidopsis thaliana in complex with camalexin
PDB Compounds: (E:) glutathione s-transferase f2

SCOPe Domain Sequences for d5a5ke1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a5ke1 c.47.1.5 (E:3-86) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafedgd
lklfesraitqyiahryenqgtnl

SCOPe Domain Coordinates for d5a5ke1:

Click to download the PDB-style file with coordinates for d5a5ke1.
(The format of our PDB-style files is described here.)

Timeline for d5a5ke1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5a5ke2
View in 3D
Domains from other chains:
(mouse over for more information)
d5a5ka1, d5a5ka2, d5a5kb1, d5a5kb2, d5a5kc1, d5a5kc2, d5a5kd1, d5a5kd2, d5a5kf1, d5a5kf2, d5a5kg1, d5a5kg2, d5a5kh1, d5a5kh2, d5a5ki1, d5a5ki2, d5a5kj1, d5a5kj2, d5a5kk1, d5a5kk2, d5a5kl1, d5a5kl2, d5a5km1, d5a5km2, d5a5kn1, d5a5kn2, d5a5ko1, d5a5ko2, d5a5kp1, d5a5kp2, d5a5kq1, d5a5kq2, d5a5kr1, d5a5kr2, d5a5ks1, d5a5ks2, d5a5kt1, d5a5kt2, d5a5ku1, d5a5ku2, d5a5kv1, d5a5kv2, d5a5kw1, d5a5kw2, d5a5kx1, d5a5kx2