Lineage for d5a5kf2 (5a5k F:87-212)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2713549Protein automated matches [226848] (14 species)
    not a true protein
  7. 2713723Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [318877] (4 PDB entries)
  8. 2713747Domain d5a5kf2: 5a5k F:87-212 [319233]
    Other proteins in same PDB: d5a5ka1, d5a5kb1, d5a5kc1, d5a5kd1, d5a5ke1, d5a5kf1, d5a5kg1, d5a5kh1, d5a5ki1, d5a5kj1, d5a5kk1, d5a5kl1, d5a5km1, d5a5kn1, d5a5ko1, d5a5kp1, d5a5kq1, d5a5kr1, d5a5ks1, d5a5kt1, d5a5ku1, d5a5kv1, d5a5kw1, d5a5kx1
    automated match to d1gnwa1
    complexed with 7wb

Details for d5a5kf2

PDB Entry: 5a5k (more details), 2.77 Å

PDB Description: atgstf2 from arabidopsis thaliana in complex with camalexin
PDB Compounds: (F:) glutathione s-transferase f2

SCOPe Domain Sequences for d5a5kf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a5kf2 a.45.1.1 (F:87-212) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
lqtdsknisqyaimaigmqvedhqfdpvasklafeqifksiyglttdeavvaeeeaklak
vldvyearlkefkylagetftltdlhhipaiqyllgtptkklfterprvnewvaeitkrp
asekvq

SCOPe Domain Coordinates for d5a5kf2:

Click to download the PDB-style file with coordinates for d5a5kf2.
(The format of our PDB-style files is described here.)

Timeline for d5a5kf2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5a5kf1
View in 3D
Domains from other chains:
(mouse over for more information)
d5a5ka1, d5a5ka2, d5a5kb1, d5a5kb2, d5a5kc1, d5a5kc2, d5a5kd1, d5a5kd2, d5a5ke1, d5a5ke2, d5a5kg1, d5a5kg2, d5a5kh1, d5a5kh2, d5a5ki1, d5a5ki2, d5a5kj1, d5a5kj2, d5a5kk1, d5a5kk2, d5a5kl1, d5a5kl2, d5a5km1, d5a5km2, d5a5kn1, d5a5kn2, d5a5ko1, d5a5ko2, d5a5kp1, d5a5kp2, d5a5kq1, d5a5kq2, d5a5kr1, d5a5kr2, d5a5ks1, d5a5ks2, d5a5kt1, d5a5kt2, d5a5ku1, d5a5ku2, d5a5kv1, d5a5kv2, d5a5kw1, d5a5kw2, d5a5kx1, d5a5kx2