Lineage for d5c5bd1 (5c5b D:5-273)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2343255Fold a.238: BAR/IMD domain-like [116747] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 2343256Superfamily a.238.1: BAR/IMD domain-like [103657] (5 families) (S)
    core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends
  5. 2343315Family a.238.1.0: automated matches [191660] (1 protein)
    not a true family
  6. 2343316Protein automated matches [191240] (2 species)
    not a true protein
  7. 2343317Species Human (Homo sapiens) [TaxId:9606] [189695] (6 PDB entries)
  8. 2343326Domain d5c5bd1: 5c5b D:5-273 [318707]
    Other proteins in same PDB: d5c5ba1, d5c5ba2, d5c5ba3, d5c5bb2, d5c5bc1, d5c5bc2, d5c5bc3, d5c5bd2
    automated match to d2z0oa1
    complexed with gol

Details for d5c5bd1

PDB Entry: 5c5b (more details), 2.9 Å

PDB Description: crystal structure of human appl bar-ph heterodimer
PDB Compounds: (D:) DCC-interacting protein 13-beta

SCOPe Domain Sequences for d5c5bd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c5bd1 a.238.1.0 (D:5-273) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dkllleealqdspqtrsllsvfeedagtltdytnqllqamqrvygaqnemclatqqlskq
llayekqnfalgkgdeevistlhyfskvvdelnllhtelakqladtmvlpiiqfrekdlt
evstlkdlfglasnehdlsmakysrlpkkkenekvktevgkevaaarrkqhlsslqyyca
lnalqyrkqmammepmigfahgqinffkkgaemfskrmdsflssvadmvqsiqveleaea
ekmrvsqqellsvdesvytpdsdvaapqi

SCOPe Domain Coordinates for d5c5bd1:

Click to download the PDB-style file with coordinates for d5c5bd1.
(The format of our PDB-style files is described here.)

Timeline for d5c5bd1: