SCOPe 2.08: Domain d5c5bd2: 5c5b D:274-375

Lineage for d5c5bd2 (5c5b D:274-375)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.0: automated matches [191311] (1 protein)
   not a true family

6. Protein automated matches [190052] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186914] (120 PDB entries)

8. Domain d5c5bd2: 5c5b D:274-375 [318708]
   Other proteins in same PDB: d5c5ba1, d5c5ba3, d5c5bb1, d5c5bc1, d5c5bc3, d5c5bd1
   automated match to d2z0oa2
   complexed with gol

Details for d5c5bd2

PDB Entry: 5c5b, 2.9 Å

PDB Description: crystal structure of human appl bar-ph heterodimer

PDB Compounds: (D:) DCC-interacting protein 13-beta

SCOPe Domain Sequences for d5c5bd2:

Sequence; same for both SEQRES and ATOM records:

>d5c5bd2 b.55.1.0 (D:274-375) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nrnliqkagylnlrnktglvtttwerlyfftqggnlmcqprgavaggliqdldncsvmav
dcedrrycfqittpngksgiilqaesrkeneewicainnisr

Timeline for d5c5bd2:

• d5c5bd2 first appeared in SCOPe 2.06
  
• d5c5bd2 appears in SCOPe 2.07